PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_13790V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 541aa    MW: 59722.9 Da    PI: 7.7708
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_13790V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-17156201147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg W + Ede+l ++v q+G+ +W++Ia+++  gR++k+c++rw++ 
  Pp3c4_13790V3.2.p 156 RGHWRPAEDEKLRELVSQYGPQNWNLIAEKLH-GRSGKSCRLRWFNQ 201
                        899*****************************.***********996 PP

2Myb_DNA-binding50.64.5e-16208252147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r ++T++E+e+l+ a+  +G++ W+ Iar +  gRt++ +k++w+ +
  Pp3c4_13790V3.2.p 208 RRPFTEDEEERLLAAHSFHGNK-WAMIARLFL-GRTDNAVKNHWHVV 252
                        679*******************.********9.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.764151206IPR017930Myb domain
SuperFamilySSF466897.49E-28155249IPR009057Homeodomain-like
SMARTSM007172.6E-14155204IPR001005SANT/Myb domain
PfamPF002493.7E-16156201IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-27157209IPR009057Homeodomain-like
CDDcd001674.07E-13159200No hitNo description
PROSITE profilePS5129418.985207257IPR017930Myb domain
SMARTSM007172.0E-13207255IPR001005SANT/Myb domain
PfamPF002492.6E-12208251IPR001005SANT/Myb domain
CDDcd001674.35E-10210253No hitNo description
Gene3DG3DSA:1.10.10.609.2E-19210256IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MCLHFAEEQT KGMQSYELHY TTSGQLSSRQ QQMASSCSHS HAGHSSPGVT TSSTSAETTT  60
YVTDGEGTSN SGSDVTPVTC KASTIPFQAL GSLPSEEGQL WWMRAGYNSD VKQFSDGEMD  120
QASVDEMKES TSEDVDLKFH NMDTMDGAVQ SKLCPRGHWR PAEDEKLREL VSQYGPQNWN  180
LIAEKLHGRS GKSCRLRWFN QLDPRINRRP FTEDEEERLL AAHSFHGNKW AMIARLFLGR  240
TDNAVKNHWH VVMARKFRER SRSSGRRKAQ EPRRGRRPSS SSEQHTTSSE EVSDVSLSTH  300
HGQVLNPSSL SRSTKNSYTS TSTPSFQPGF ILPHHEPSRI LSSSPHSESS KKGSSLLSSS  360
TTALARPSPA SRWLSQSAEL GSQTQYGQKR VPQTDAVPQS TGFLPELKIR PERNCKGPTA  420
AQWVPSLVSP FPSARGNQRD EHARNLWASS FRAELHGQIQ DHHGHGVQNL VNHLEGGFEV  480
RKRAEQLGLQ TDLEAFAAWG MTNHGQEITT SQSEAAPAIS FIDFLGVGVV KENSSSSPVC  540
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-291562567107B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S219_84V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.15e-64myb domain protein 105